Loading...
Statistics
Advertisement

www.sgeo.eu
www.sgeo.eu/

Sgeo.eu

Advertisement
Conversion Technology Metas Server
Sgeo.eu is hosted in Italy / Arezzo . Sgeo.eu doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/8.5.

Technologies in use by Sgeo.eu

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Microsoft-IIS/8.5

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Sgeo.eu

Missing HTTPS protocol.

    Meta - Sgeo.eu

    Number of occurences: 0

    Server / Hosting

    • IP: 62.149.128.45
    • Latitude: 43.42
    • Longitude: 11.88
    • Country: Italy
    • City: Arezzo

    Rname

    • dns.technorail.com
    • dns4.arubadns.cz
    • dns3.arubadns.net
    • dns2.technorail.com
    • mx.sgeo.eu

    Target

    • hostmaster.technorail.com

    HTTP Header Response

    HTTP/1.1 200 OK Cache-Control: private Content-Length: 306 Content-Type: text/html Server: Microsoft-IIS/8.5 Set-Cookie: ASPSESSIONIDQSSCARCC=MJMNIJNCICDOBNCBEKLHCOIH; path=/ X-Powered-By: ASP.NET Date: Tue, 26 Jul 2016 02:20:00 GMT X-Cache: MISS from s_sr109 X-Cache-Lookup: MISS from s_sr109:80 Via: 1.1 s_sr109 (squid/3.5.14) Connection: keep-alive

    DNS

    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.72
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.154
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.166
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.151
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.157
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.74
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.160
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: A
    4. ip: 62.149.128.163
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns.technorail.com
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns4.arubadns.cz
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns3.arubadns.net
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: NS
    4. target: dns2.technorail.com
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: SOA
    4. mname: dns.technorail.com
    5. rname: hostmaster.technorail.com
    6. serial: 1
    7. refresh: 86400
    8. retry: 7200
    9. expire: 2592000
    10. minimum-ttl: 86400
    host: sgeo.eu
    1. class: IN
    2. ttl: 21600
    3. type: MX
    4. pri: 10
    5. target: mx.sgeo.eu

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.geo.eu, www.segeo.eu, www.egeo.eu, www.swgeo.eu, www.wgeo.eu, www.sdgeo.eu, www.dgeo.eu, www.sxgeo.eu, www.xgeo.eu, www.sfgeo.eu, www.fgeo.eu, www.sggeo.eu, www.ggeo.eu, www.stgeo.eu, www.tgeo.eu, www.seo.eu, www.sgseo.eu, www.sseo.eu, www.sgxeo.eu, www.sxeo.eu, www.sgyeo.eu, www.syeo.eu, www.sgheo.eu, www.sheo.eu, www.sgneo.eu, www.sneo.eu, www.sgceo.eu, www.sceo.eu, www.sgdeo.eu, www.sdeo.eu, www.sgeeo.eu, www.seeo.eu, www.sgreo.eu, www.sreo.eu, www.sgteo.eu, www.steo.eu, www.sgbeo.eu, www.sbeo.eu, www.sgveo.eu, www.sveo.eu, www.sgo.eu, www.sgexo.eu, www.sgxo.eu, www.sgeso.eu, www.sgso.eu, www.sgewo.eu, www.sgwo.eu, www.sgero.eu, www.sgro.eu, www.sgefo.eu, www.sgfo.eu, www.sgevo.eu, www.sgvo.eu, www.sgeco.eu, www.sgco.eu, www.sgeqo.eu, www.sgqo.eu, www.sgeao.eu, www.sgao.eu, www.sgeyo.eu, www.sgyo.eu, www.sge.eu, www.sgeob.eu, www.sgeb.eu, www.sgeoh.eu, www.sgeh.eu, www.sgeog.eu, www.sgeg.eu, www.sgeoj.eu, www.sgej.eu, www.sgeom.eu, www.sgem.eu, www.sgeo .eu, www.sge .eu, www.sgeov.eu, www.sgev.eu,

    Other websites we recently analyzed

    1. Meaningful Directions Therapeutic Services
      At Meaningful Directions, our highly trained, experienced clinicians are here to assist families, couples and individuals of all ages through life's difficulties. The diverse backgrounds of our staff counselors provide the opportunity for clients to be matched appropriately to a clinician who can meet their unique needs, promoting a successful and positive experience. We also understand the connection between various aspects of an individual's life and their work in a counseling setting. We value collaborative efforts between the clinician, family, schools supports and outside service providers. Whether marital or family discord are impacting your life or your child's behavior has become difficult at home or in school, or you simply seek an empathetic ear, Meaningful Directions can help.
      Scottsdale (United States) - 97.74.144.203
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript
      Number of Javascript: 2
      Number of meta tags: 3
    2. www.casasillinois.com
      Scottsdale (United States) - 184.168.221.26
      Server software: Microsoft-IIS/7.5
      Technology: Html
    3. Private Krankenversicherung - Kostenloses Angebot zur privaten Krankenversicherung anfordern
      Private Krankenversicherung - Kostenloses Angebot zur privaten Krankenversicherung anfordern
      Germany - 31.185.110.57
      Server software: Apache/2.4.10 (Debian)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 3
    4. RankUp Running
      New York (United States) - 104.236.221.201
      Server software: Apache/2.4.7 (Ubuntu)
      Technology: CloudFlare, CSS, Google Font API, Html, Html5, Javascript, jQuery UI, Php, Facebook Box
      Number of Javascript: 9
      Number of meta tags: 2
    5. landwirtschaftliche-direktvermarktung.de
      Germany - 82.165.89.168
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    6. seakayakbrands.com
      New York (United States) - 69.172.201.153
      Server software: DOSarrest
      Technology: Html, Javascript
      Number of meta tags: 1
    7. IVY'S ATTIC - Englewood, Florida Furniture Store
      IVY'S ATTIC Englewood, Florida selection of sofas, recliners, chairs, tables, accent tables, dining furniture, office furniture, living room furniture, bedroom furniture and more.
      Boardman (United States) - 52.26.98.107
      Server software: Microsoft-IIS/8.5
      Technology: Google Adsense, CSS, Html, Javascript, jQuery Cycle, Google Analytics
      Number of Javascript: 4
      Number of meta tags: 2
    8. topsecurityfilesafe.com
      Scottsdale (United States) - 184.168.221.35
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    9. mdluxuryrealestateagent.com
      Scottsdale (United States) - 184.168.221.60
      Server software: squid/3.5.6
      Technology: Html, Html5, Iframe, Php
    10. East Northamptonshire Comunity Network
      United Kingdom - 79.170.40.246
      Server software: Apache/2.4.23 (Unix)
      Technology: Html
      Number of meta tags: 1

    Check Other Websites